PDB entry 3mjp

View 3mjp on RCSB PDB site
Description: Crystal structure determination of Japanese quail (Coturnix coturnix japonica) hemoglobin at 2.76 Angstrom resolution
Class: oxygen storage, oxygen transport
Keywords: Avian hemoglobin, High oxygen affinity, Oxygen binding, Oxygen transport, OXYGEN STORAGE
Deposited on 2010-04-13, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.268
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-A
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mjpa_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mjpb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-A
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mjpc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mjpd_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mjpA (A:)
    vlsaadktnvkgifakiaghaeeygaealdrmfttypqtktyfphfdvshgsaqikghgk
    kvaaalveaanhiddiagtlsklsdlhaqklrvdpvnfkllgqcflvvvaihhpaaltpe
    vhasldkflcavgtvltakyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mjpB (B:)
    vhwsaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahftk
    dftpecqaawqklvrvvahalarkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mjpC (C:)
    vlsaadktnvkgifakiaghaeeygaealdrmfttypqtktyfphfdvshgsaqikghgk
    kvaaalveaanhiddiagtlsklsdlhaqklrvdpvnfkllgqcflvvvaihhpaaltpe
    vhasldkflcavgtvltakyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mjpD (D:)
    vhwsaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahftk
    dftpecqaawqklvrvvahalarkyh