PDB entry 3mjm

View 3mjm on RCSB PDB site
Description: His257Ala mutant of dihydroorotase from E. coli
Class: hydrolase
Keywords: DHOase, dihydroorotase, TIM barrel, hydrolase
Deposited on 2010-04-13, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Escherichia coli ATCC 8739 [TaxId:481805]
    Gene: EcolC_2538, pyrC
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1IV40
      • engineered (256)
    Domains in SCOPe 2.07: d3mjma_
  • Chain 'B':
    Compound: dihydroorotase
    Species: Escherichia coli ATCC 8739 [TaxId:481805]
    Gene: EcolC_2538, pyrC
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1IV40
      • engineered (256)
    Domains in SCOPe 2.07: d3mjmb_
  • Heterogens: ZN, DOR, NCD, CP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mjmA (A:)
    tapsqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrq
    rildavpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvd
    aimpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehitt
    kdaadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvas
    gfnrvflgtdsaphararkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngp
    qfyglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjmA (A:)
    psqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqri
    ldavpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdai
    mpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkd
    aadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgf
    nrvflgtdsaphararkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqf
    yglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mjmB (B:)
    tapsqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrq
    rildavpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvd
    aimpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehitt
    kdaadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvas
    gfnrvflgtdsaphararkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngp
    qfyglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjmB (B:)
    sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
    davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
    pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
    adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
    rvflgtdsaphararkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
    glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk