PDB entry 3mji

View 3mji on RCSB PDB site
Description: Activation of catalytic cysteine without a base in a Mutant Penicillin Acylase Precursor
Class: hydrolase
Keywords: zymogen, hydrolase, penicillin, autoproteolysis, antibiotic resistance, catalysis, penicillin v acylase, amidase
Deposited on 2010-04-12, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin acylase
    Species: Bacillus sphaericus [TaxId:1421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12256 (0-End)
      • conflict (3)
      • conflict (100)
    Domains in SCOPe 2.07: d3mjia_
  • Chain 'B':
    Compound: penicillin acylase
    Species: Bacillus sphaericus [TaxId:1421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12256 (0-End)
      • conflict (3)
      • conflict (100)
    Domains in SCOPe 2.07: d3mjib_
  • Chain 'C':
    Compound: penicillin acylase
    Species: Bacillus sphaericus [TaxId:1421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12256 (0-End)
      • conflict (3)
      • conflict (100)
    Domains in SCOPe 2.07: d3mjic_
  • Chain 'D':
    Compound: penicillin acylase
    Species: Bacillus sphaericus [TaxId:1421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12256 (0-End)
      • conflict (3)
      • conflict (100)
    Domains in SCOPe 2.07: d3mjid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mjiA (A:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnqvnvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjiA (A:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mjiB (B:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnqvnvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjiB (B:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnqv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mjiC (C:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnqvnvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjiC (C:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mjiD (D:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnqvnvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjiD (D:)
    mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
    gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
    dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
    gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
    ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
    risavslmaenlnsqdlitfewdrkqdikqlnq