PDB entry 3mjg

View 3mjg on RCSB PDB site
Description: The structure of a platelet derived growth factor receptor complex
Class: Hormone/Transferase
Keywords: protein-protein complex, growth factor-receptor complex, Transferase-Hormone complex, Hormone-Transferase complex
Deposited on 2010-04-12, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet-derived growth factor subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDGF2, PDGFB, SIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mjga_
  • Chain 'B':
    Compound: Platelet-derived growth factor subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDGF2, PDGFB, SIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mjgb_
  • Chain 'X':
    Compound: Beta-type platelet-derived growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PDGFRB
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Beta-type platelet-derived growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PDGFRB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NDG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mjgA (A:)
    egdpipeelyemlsdhsirsfddlqrllhgdpgeedgaeldlnmtrshsggeleslargr
    rslgsltiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvq
    crptqvqlrpvqvrkieivrkkpifkkatvtledhlackcetvaahhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjgA (A:)
    tiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcrptqv
    qlrpvqvrkieivrkkpifkkatvtledhlackcetv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mjgB (B:)
    egdpipeelyemlsdhsirsfddlqrllhgdpgeedgaeldlnmtrshsggeleslargr
    rslgsltiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvq
    crptqvqlrpvqvrkieivrkkpifkkatvtledhlackcetvaahhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjgB (B:)
    lgsltiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcr
    ptqvqlrpvqvrkieivrkkpifkkatvtledhlackcetv
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.