PDB entry 3mjf

View 3mjf on RCSB PDB site
Description: Phosphoribosylamine-glycine ligase from Yersinia pestis
Class: ligase
Keywords: structural genomics, phosphoribosylamine-glycine ligase, Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2010-04-12, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Yersinia pestis [TaxId:214092]
    Gene: purD, y0501, YPO3729, YP_3092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZAR2 (3-430)
      • expression tag (2)
    Domains in SCOPe 2.07: d3mjfa1, d3mjfa2, d3mjfa3, d3mjfa4
  • Heterogens: GOL, PGE, PEG, EDO, BME, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mjfA (A:)
    snamniliignggrehalgwkaaqspladkiyvapgnagtaleptlenvdiaatdiagll
    afaqshdigltivgpeaplvigvvdafraaglaifgptqaaaqlegskaftkdflarhni
    psaeyqnftdveaalayvrqkgapivikadglaagkgvivamtqeeaetavndmlagnaf
    gdaghrivveefldgeeasfivmvdgenvlpmatsqdhkrvgdgdtgpntggmgayspap
    vvtddvhqrvmdqviwptvrgmaaegniytgflyaglmisadgqpkviefncrfgdpetq
    pimlrmrsdlvelclagtqgklnektsdwderpslgvvlaaggypadyrqgdvihglpqq
    evkdgkvfhagtklngnhevvtnggrvlcvtalgetvaqaqqyayqlaegiqwegvfcrk
    digyraiargk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjfA (A:)
    amniliignggrehalgwkaaqspladkiyvapgnagtaleptlenvdiaatdiagllaf
    aqshdigltivgpeaplvigvvdafraaglaifgptqaaaqlegskaftkdflarhnips
    aeyqnftdveaalayvrqkgapivikadglaagkgvivamtqeeaetavndmlagnafgd
    aghrivveefldgeeasfivmvdgenvlpmatsqdhkrvgdgdtgpntggmgayspapvv
    tddvhqrvmdqviwptvrgmaaegniytgflyaglmisadgqpkviefncrfgdpetqpi
    mlrmrsdlvelclagtqgklnektsdwderpslgvvlaaggypadyrqgdvihglpqqev
    kdgkvfhagtklngnhevvtnggrvlcvtalgetvaqaqqyayqlaegiqwegvfcrkdi
    gyraiargk