PDB entry 3mj9

View 3mj9 on RCSB PDB site
Description: Crystal structure of JAML in complex with the stimulatory antibody HL4E10
Class: immune system
Keywords: IMMUNOGLOBULIN TANDEM DOMAIN, RECEPTOR-ANTIBODY COMPLEX, CELL ADHESION, CELL JUNCTION, GLYCOPROTEIN, IMMUNOGLOBULIN DOMAIN, MEMBRANE, COSTIMULATION, HAMSTER IgG, TRANSMEMBRANE, IMMUNE SYSTEM
Deposited on 2010-04-12, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Junctional adhesion molecule-like
    Species: Mus musculus [TaxId:10090]
    Gene: Amica1, Gm638, Jaml
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80UL9
      • engineered mutation (125)
      • engineered mutation (212)
  • Chain 'H':
    Compound: stimulatory hamster antibody hl4e10 fab heavy chain
    Species: CRICETULUS MIGRATORIUS [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJ9 (0-End)
  • Chain 'L':
    Compound: stimulatory hamster antibody hl4e10 fab light chain
    Species: CRICETULUS MIGRATORIUS [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJ9
    Domains in SCOPe 2.07: d3mj9l1, d3mj9l2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mj9L (L:)
    sytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdh
    fsgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlgqpnaapsvtlf
    ppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsksdskymatsylt
    mtadawksrntfickvthggntvekslspsacs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mj9L (L:)
    ytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdhf
    sgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlgqpnaapsvtlfp
    psseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsksdskymatsyltm
    tadawksrntfickvthggntvekslsps