PDB entry 3mj7

View 3mj7 on RCSB PDB site
Description: Crystal structure of the complex of JAML and Coxsackie and Adenovirus receptor, CAR
Deposited on 2010-04-12, released 2010-09-22
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Junctional adhesion molecule-like
    Species: Mus musculus [TaxId:10090]
    Gene: Amica1, Gm638, Jaml
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80UL9
      • engineered mutation (125)
      • engineered mutation (212)
  • Chain 'B':
    Compound: Coxsackievirus and adenovirus receptor homolog
    Species: Mus musculus [TaxId:10090]
    Gene: Car, Cxadr
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mj7A (A:)
    rsqglpgltvsspqlrvhvgesvlmgcvvqrteekhvdrvdwlfskdkddaseyvlfyys
    nlsvptgrfqnrshlvgdtfhndgslllqdvqkadegiytceirlknesmvmkkpvelwv
    lpeeprdlrvrvgdttqmrcsiqsteekrvtkvnwmfssgshteeetvlsydsnmrsgkf
    qslgrfrnrvdltgdisrndgsiklqtvkesdqgiytcsiyvgklesrktivlhvvqdef
    qrtisptpptdkgqqgilngnqhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mj7A (A:)
    pqlrvhvgesvlmgcvvqrteekhvdrvdwlfskdkddaseyvlfyysnlsvptgrfqnr
    shlvgdtfhndgslllqdvqkadegiytceirlknesmvmkkpvelwvlpeeprdlrvrv
    gdttqmrcsiqsteekrvtkvnwmfssgshteeetvlsydsnmrsgkfqslgrfrnrvdl
    tgdisrndgsiklqtvkesdqgiytcsiyvgklesrktivlhvvqdefq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mj7B (B:)
    sglsittpeqriekakgetaylpckftlspedqgpldiewlispsdnqivdqviilysgd
    kiydnyypdlkgrvhftsndvksgdasinvtnlqlsdigtyqckvkkapgvankkflltv
    lvkpsgtrcfvdgseeigndfklkcepkegslplqfewqklsdsqtmptpwlaemtspvi
    svknasseysgtysctvqnrvgsdqcmlrldvvppsnrahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mj7B (B:)
    ittpeqriekakgetaylpckftlspedqgpldiewlispsdnqivdqviilysgdkiyd
    nyypdlkgrvhftsndvksgdasinvtnlqlsdigtyqckvkkapgvankkflltvlvkp
    sgtrcfvdgndfklkcepkegslplqfewqkmptpwlaemtspvisvknysctvqnrvgs
    dqcmlrldv