PDB entry 3mj6

View 3mj6 on RCSB PDB site
Description: Crystal structure of the gammadelta T cell costimulatory receptor Junctional Adhesion Molecule-Like Protein, JAML
Deposited on 2010-04-12, released 2010-09-22
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.172
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Junctional adhesion molecule-like
    Species: Mus musculus [TaxId:10090]
    Gene: Amica1, Gm638, Jaml
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80UL9
      • engineered mutation (125)
      • engineered mutation (212)
  • Heterogens: NAG, NA, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mj6A (A:)
    rsqglpgltvsspqlrvhvgesvlmgcvvqrteekhvdrvdwlfskdkddaseyvlfyys
    nlsvptgrfqnrshlvgdtfhndgslllqdvqkadegiytceirlknesmvmkkpvelwv
    lpeeprdlrvrvgdttqmrcsiqsteekrvtkvnwmfssgshteeetvlsydsnmrsgkf
    qslgrfrnrvdltgdisrndgsiklqtvkesdqgiytcsiyvgklesrktivlhvvqdef
    qrtisptpptdkgqqgilngnqhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mj6A (A:)
    spqlrvhvgesvlmgcvvqrteekhvdrvdwlfskdkddaseyvlfyysnlsvptgrfqn
    rshlvgdtfhndgslllqdvqkadegiytceirlknesmvmkkpvelwvlpeeprdlrvr
    vgdttqmrcsiqsteekrvtkvnwmfssgshteeetvlsydsnmrsgkfqslgrfrnrvd
    ltgdisrndgsiklqtvkesdqgiytcsiyvgklesrktivlhvvqd