PDB entry 3mj4

View 3mj4 on RCSB PDB site
Description: crystal structure of udp-galactopyranose mutase in complex with phosphonate analog of udp-galactopyranose
Deposited on 2010-04-12, released 2010-10-20
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: udp-galactopyranose mutase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR_A0367, DR_AO367
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, UDP, GOL, URM, XYL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mj4A (A:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4A (A:)
    qeskgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygp
    hifhtnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqvee
    ffasvaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtn
    rdnryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaf
    fdfcygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvy
    eypraegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatf
    rrlqg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mj4B (B:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4B (B:)
    kgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphif
    htnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeffa
    svaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrdn
    ryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffdf
    cygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyeyp
    raegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrrl
    qgq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mj4C (C:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4C (C:)
    kgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphif
    htnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeffa
    svaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrdn
    ryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffdf
    cygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyeyp
    raegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrrl
    qgq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mj4D (D:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4D (D:)
    fdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphifht
    nskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeffasv
    aekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrdnry
    fadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffdfcy
    gklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyeypra
    egdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrrlq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mj4E (E:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4E (E:)
    gfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphifh
    tnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeffas
    vaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrdnr
    yfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffdfc
    ygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyeypr
    aegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrrlq
    g
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mj4F (F:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4F (F:)
    kgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphif
    htnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeffa
    svaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrdn
    ryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffdf
    cygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyeyp
    raegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrrl
    qgqp
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mj4G (G:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4G (G:)
    skgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphi
    fhtnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeff
    asvaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrd
    nryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffd
    fcygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyey
    praegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrr
    lqg
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mj4H (H:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4H (H:)
    skgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphi
    fhtnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeff
    asvaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrd
    nryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffd
    fcygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyey
    praegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrr
    lqgq
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3mj4I (I:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4I (I:)
    eskgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygph
    ifhtnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveef
    fasvaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnr
    dnryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaff
    dfcygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvye
    ypraegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfr
    rlqg
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3mj4J (J:)
    mpmtdlpsavtnerteqtnttneqqeskgfdylivgagfagsvlaerlassgqrvlivdr
    rphiggnaydcyddagvlihpygphifhtnskdvfeylsrftewrpyqhrvlasvdgqll
    pipinldtvnrlyglnltsfqveeffasvaekveqvrtsedvvvskvgrdlynkffrgyt
    rkqwgldpseldasvtarvptrtnrdnryfadtyqamplhgytrmfqnmlsspnikvmln
    tdyreiadfipfqhmiytgpvdaffdfcygklpyrslefrhethdteqllptgtvnypnd
    yaytrvsefkhitgqrhhqtsvvyeypraegdpyypvprpenaelykkyealadaaqdvt
    fvgrlatyryynmdqvvaqalatfrrlqgqpeqgnae
    

    Sequence, based on observed residues (ATOM records):
    >3mj4J (J:)
    skgfdylivgagfagsvlaerlassgqrvlivdrrphiggnaydcyddagvlihpygphi
    fhtnskdvfeylsrftewrpyqhrvlasvdgqllpipinldtvnrlyglnltsfqveeff
    asvaekveqvrtsedvvvskvgrdlynkffrgytrkqwgldpseldasvtarvptrtnrd
    nryfadtyqamplhgytrmfqnmlsspnikvmlntdyreiadfipfqhmiytgpvdaffd
    fcygklpyrslefrhethdteqllptgtvnypndyaytrvsefkhitgqrhhqtsvvyey
    praegdpyypvprpenaelykkyealadaaqdvtfvgrlatyryynmdqvvaqalatfrr
    lqg