PDB entry 3mj0

View 3mj0 on RCSB PDB site
Description: Crystal Structure of Drosophia Ago-PAZ domain in complex with 3'-end 2'-O-methylated RNA
Class: RNA/RNA binding protein
Keywords: Argonaut, PAZ domain, 3'-end 2'-O-methylated ssRNA, RNA-RNA BINDING PROTEIN complex
Deposited on 2010-04-12, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein argonaute-2
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: AGO2, CG7439
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VUQ5 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3mj0a1, d3mj0a2
  • Chain 'B':
    Compound: RNA (5'-r(*cp*gp*up*up*ap*cp*gp*cp*(omu))-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mj0A (A:)
    ssmpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngl
    srapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsieegq
    alnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mj0A (A:)
    ssmpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngl
    srapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
    

  • Chain 'B':
    No sequence available.