SCOPe 2.07: Structural Classification of Proteins

PDB entry 3miw

View 3miw on RCSB PDB site
Description: Crystal Structure of Rotavirus NSP4
Class: viral protein
Keywords: rotavirus enterotoxin, non structural protein, nsp4, pentameric coiled coil, virulence, viral protein
Deposited on 2010-04-12, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.264
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwa_
Chain 'B':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwb_
Chain 'C':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwc_
Chain 'D':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwd_
Chain 'E':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwe_
Chain 'F':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwf_
Chain 'G':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwg_
Chain 'H':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
Domains in SCOPe 2.07: d3miwh_
Chain 'I':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwi_
Chain 'J':
Compound: Non-structural glycoprotein 4
Species: Human rotavirus G4 [TaxId:10960]
Gene: G10
Database cross-references and differences (RAF-indexed):
- Uniprot Q82035 (1-End)
  - initiating methionine (0)
Domains in SCOPe 2.07: d3miwj_
Heterogens: EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3miwA (A:)
mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm