PDB entry 3miv

View 3miv on RCSB PDB site
Description: Structure of Banana lectin - Glc-alpha(1,2)-Glc complex
Deposited on 2010-04-12, released 2010-09-08
The last revision was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.222
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: lectin
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mivA (A:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsgg
    tpheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagk
    isgffgrggdfidaigvylep
    

    Sequence, based on observed residues (ATOM records):
    >3mivA (A:)
    aikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggtph
    eivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagkisg
    ffgrggdfidaigvylep
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mivB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsgg
    tpheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagk
    isgffgrggdfidaigvylep
    

    Sequence, based on observed residues (ATOM records):
    >3mivB (B:)
    ngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggt
    pheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagki
    sgffgrggdfidaigvylep