PDB entry 3mit

View 3mit on RCSB PDB site
Description: Structure of Banana lectin-alpha-D-mannose complex
Class: sugar binding protein
Keywords: all beta sheet protein, beta prism-I fold, mannose specific, sugar binding protein
Deposited on 2010-04-12, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.205
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mita_
  • Chain 'B':
    Compound: lectin
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mitb_
  • Heterogens: MAN, ZN, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mitA (A:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsgg
    tpheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagk
    isgffgrggdfidaigvylep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mitA (A:)
    aikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggtph
    eivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagkisg
    ffgrggdfidaigvylep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mitB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsgg
    tpheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagk
    isgffgrggdfidaigvylep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mitB (B:)
    ngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggt
    pheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagki
    sgffgrggdfidaigvylep