PDB entry 3mis

View 3mis on RCSB PDB site
Description: I-MsoI re-designed for altered DNA cleavage specificity (-8G)
Deposited on 2010-04-12, released 2010-05-19
The last revision was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mso-8G
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MIS (0-160)
  • Chain 'B':
    Compound: Mso-8G
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MIS (0-160)
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*ap*gp*gp*ap*cp*gp*tp*cp*gp*tp*gp*ap*gp*ap*cp*ap*gp*cp*tp*cp*cp*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*gp*gp*ap*gp*cp*tp*gp*tp*cp*tp*cp*ap*cp*gp*ap*cp*gp*tp*cp*cp*tp*gp*c)-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3misA (A:)
    tlqpteaayiagfldgdgsiyakleprpdykdikyqvrlaisfiqrkdkfpylqdiydql
    gkrgnlrkdrgdgiadytiygsthlsiilpdlvpylrikkkqanrilhiinlypqaqknp
    skfldlvkivddvqnlnkradelkstnydrlleeflkagki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3misB (B:)
    tlqpteaayiagfldgdgsiyakleprpdykdikyqvrlaisfiqrkdkfpylqdiydql
    gkrgnlrkdrgdgiadytiygsthlsiilpdlvpylrikkkqanrilhiinlypqaqknp
    skfldlvkivddvqnlnkradelkstnydrlleeflkagki
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.