PDB entry 3min

View 3min on RCSB PDB site
Description: nitrogenase mofe protein from azotobacter vinelandii, oxidized state
Deposited on 1996-12-20, released 1997-04-01
The last revision prior to the SCOP 1.61 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d3mina_
  • Chain 'B':
    Domains in SCOP 1.61: d3minb_
  • Chain 'C':
    Domains in SCOP 1.61: d3minc_
  • Chain 'D':
    Domains in SCOP 1.61: d3mind_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3minA (A:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3minA (A:)
    sreevesliqevlevypekarkdrnkhlavnciisnkksqpglmtirgcayagskgvvwg
    pikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdivfggdkklak
    lidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrcegfrgvsqsl
    ghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrilleemglrcvaqw
    sgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptktieslraia
    akfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvigayedlgme
    vvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsgikekfifqk
    mgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3minB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3minC (C:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3minC (C:)
    sreevesliqevlevypekarkdrnkhlavnciisnkksqpglmtirgcayagskgvvwg
    pikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdivfggdkklak
    lidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrcegfrgvsqsl
    ghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrilleemglrcvaqw
    sgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptktieslraia
    akfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvigayedlgme
    vvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsgikekfifqk
    mgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3minD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr