PDB entry 3mim
View 3mim on RCSB PDB site
Description: X-ray Snapshot of HIV-1 Protease in Action: Observation of Tetrahedral Intermediate and Its SIHB with Catalytic Aspartate
Class: hydrolase
Keywords: HIV-1 protease, Short ionic hydrogen bond, tethered dimer, tetrahedral intermediate, Reverse Transcriptase-RNAseH oligopeptide substrate, Reaction Mechanism, HYDROLASE
Deposited on
2010-04-11, released
2011-04-13
Made obsolete by
5yrs on
2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11706]
Gene: gag-pol, HIV-1 PR B
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3mima_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11706]
Gene: gag-pol, HIV-1 PR B
Database cross-references and differences (RAF-indexed):
- Uniprot P04585 (0-98)
- engineered mutation (94)
- expression tag (99-102)
Domains in SCOPe 2.08: d3mimb1, d3mimb2 - Chain 'X':
Compound: peptide ET(PHD)YVD
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3mimA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3mimB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnfggssg
Sequence, based on observed residues (ATOM records): (download)
>3mimB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnfggss
- Chain 'X':
No sequence available.