PDB entry 3mil

View 3mil on RCSB PDB site
Description: Crystal structure of isoamyl acetate-hydrolyzing esterase from Saccharomyces cerevisiae
Deposited on 2010-04-11, released 2010-11-24
The last revision was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoamyl acetate-hydrolyzing esterase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: EST2, IAH1, O3287, YOR126C, YOR3287C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41734 (0-237)
      • expression tag (238-239)
  • Chain 'B':
    Compound: Isoamyl acetate-hydrolyzing esterase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: EST2, IAH1, O3287, YOR126C, YOR3287C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3milA (A:)
    mdyekfllfgdsitefafntrpiedgkdqyalgaalvneytrkmdilqrgfkgytsrwal
    kilpeilkhesnivmatiflgandacsagpqsvplpefidnirqmvslmksyhirpiiig
    pglvdrekwekekseeialgyfrtnenfaiysdalaklaneekvpfvalnkafqqeggda
    wqqlltdglhfsgkgykifhdellkvietfypqyhpknmqyklkdwrdvlddgsnimsle
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3milB (B:)
    mdyekfllfgdsitefafntrpiedgkdqyalgaalvneytrkmdilqrgfkgytsrwal
    kilpeilkhesnivmatiflgandacsagpqsvplpefidnirqmvslmksyhirpiiig
    pglvdrekwekekseeialgyfrtnenfaiysdalaklaneekvpfvalnkafqqeggda
    wqqlltdglhfsgkgykifhdellkvietfypqyhpknmqyklkdwrdvlddgsnimsle
    

    Sequence, based on observed residues (ATOM records):
    >3milB (B:)
    mdyekfllfgdsitefafntrpiedgkdqyalgaalvneytrkmdilqrgfkgytsrwal
    kilpeilkhesnivmatiflgandacsagpqsvplpefidnirqmvslmksyhirpiiig
    pglvdrekwekekseeialgyfrtnenfaiysdalaklaneekvpfvalnkafqqeggda
    wqqlltdglhfsgkgykifhdellkvietfypqyhpknmqyklkdwrdvlddgsnims