PDB entry 3mib

View 3mib on RCSB PDB site
Description: Oxidized (Cu2+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound nitrite
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, bioactive peptide activation, ascorbate
Deposited on 2010-04-10, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.202
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3miba1, d3miba2
  • Heterogens: CU, NI, NO2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mibA (A:)
    fsneclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkpras
    mdtvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvgget
    gskyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvn
    adiscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvd
    vtfgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdm
    frtipaeanipipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mibA (A:)
    neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
    tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
    kyfvlqvhygdisafnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadis
    cqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfg
    dilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfrti
    paeanipi