PDB entry 3mia

View 3mia on RCSB PDB site
Description: Crystal structure of HIV-1 Tat complexed with ATP-bound human P-TEFb
Class: protein binding
Keywords: P-TEFb, Cdk9, Cyclin T1, HIV-1, Tat, PROTEIN BINDING
Deposited on 2010-04-09, released 2010-06-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC2L4, CDK9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3miaa_
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1, Cyclin T1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3miab1, d3miab2
  • Chain 'C':
    Compound: protein tat
    Species: Human immunodeficiency virus type 1 [TaxId:11706]
    Gene: TAT
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3miaA (A:)
    makqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfp
    italreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvk
    ftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslakns
    qpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlal
    isqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldp
    aqridsddalnhdffwsdpmpsdlkgmlsthltsmfeylapprrkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miaA (A:)
    vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
    kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln
    glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyr
    ppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpn
    vdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdff
    wsdpmpsdlkgmlsthltsmfeyla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3miaB (B:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miaB (B:)
    nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
    hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
    lqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhltt
    fslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqile
    ktpnrlc
    

  • Chain 'C':
    No sequence available.