PDB entry 3mi1

View 3mi1 on RCSB PDB site
Description: Axial Ligand Swapping In Double Mutant Maintains Intradiol-cleavage Chemistry in Protocatechuate 3,4-Dioxygenase
Class: oxidoreductase
Keywords: dioxygenase, non-heme, iron, homoprotocatechuate, OXIDOREDUCTASE
Deposited on 2010-04-09, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mi1a_
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mi1b_
  • Chain 'C':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mi1c_
  • Chain 'M':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (161)
    Domains in SCOPe 2.07: d3mi1m_
  • Chain 'N':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (161)
    Domains in SCOPe 2.07: d3mi1n_
  • Chain 'O':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (161)
    Domains in SCOPe 2.07: d3mi1o_
  • Heterogens: SO4, GOL, FE, CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mi1A (A:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mi1B (B:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mi1C (C:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mi1M (M:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahiyfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mi1N (N:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahiyfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mi1O (O:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahiyfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc