PDB entry 3mhy

View 3mhy on RCSB PDB site
Description: A New PII Protein Structure
Class: signaling protein
Keywords: PII protein, alpha-beta protein, homotrimer, signaling protein
Deposited on 2010-04-09, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.16
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PII-like protein Pz
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Gene: glnZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhya_
  • Chain 'B':
    Compound: PII-like protein Pz
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Gene: glnZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhyb_
  • Chain 'C':
    Compound: PII-like protein Pz
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Gene: glnZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhyc_
  • Heterogens: PG6, ATP, AKG, MG, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mhyA (A:)
    mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
    vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhyA (A:)
    mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqtvsflpkvkvevavsddq
    yeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mhyB (B:)
    mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
    vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mhyC (C:)
    mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
    vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal