PDB entry 3mhx

View 3mhx on RCSB PDB site
Description: Crystal Structure of Stenotrophomonas maltophilia FeoA complexed with Zinc: A Unique Procaryotic SH3 Domain Protein Possibly Acting as a Bacterial Ferrous Iron Transport Activating Factor
Deposited on 2010-04-09, released 2010-06-23
The last revision was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ferrous iron transport protein A
    Species: Stenotrophomonas maltophilia [TaxId:522373]
    Gene: feoA, Smlt2210
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2FQ63 (1-84)
      • expression tag (0)
      • engineered mutation (43)
  • Chain 'B':
    Compound: Putative ferrous iron transport protein A
    Species: Stenotrophomonas maltophilia [TaxId:522373]
    Gene: feoA, Smlt2210
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2FQ63 (1-84)
      • expression tag (0)
      • engineered mutation (43)
  • Heterogens: ZN, CL, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mhxA (A:)
    amtlselplhtsavvesvqdlhandaiarrlrelgfvkgeevrmvakgpvggepllvqvg
    ftrfalriseakrvvvdaasqerra
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mhxB (B:)
    amtlselplhtsavvesvqdlhandaiarrlrelgfvkgeevrmvakgpvggepllvqvg
    ftrfalriseakrvvvdaasqerra
    

    Sequence, based on observed residues (ATOM records):
    >3mhxB (B:)
    amtlselplhtsavvesvqdlhandaiarrlrelgfvkgeevrmvakgepllvqvgftrf
    alriseakrvvvdaasqerra