PDB entry 3mhw

View 3mhw on RCSB PDB site
Description: The complex crystal Structure of Urokianse and 2-Aminobenzothiazole
Class: hydrolase
Keywords: HYDROLASE, Blood coagulation, Fibrinolysis, Plasminogen activation
Deposited on 2010-04-09, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.206
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-246)
      • engineered (120)
    Domains in SCOPe 2.07: d3mhwu_
  • Heterogens: SO4, ABV, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3mhwU (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhwU (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadlahhndiallkirskegrcaqpsrtiqtis
    lpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttkm
    lcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpwi
    rshtke