PDB entry 3mhv

View 3mhv on RCSB PDB site
Description: Crystal Structure of Vps4 and Vta1
Deposited on 2010-04-09, released 2010-10-06
The last revision was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.298
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein VTA1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VTA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vacuolar protein sorting-associated protein 4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52917 (2-116)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mhvA (A:)
    draskieqiqklakyaisalnyedlptakdeltkaldllnsi
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mhvC (C:)
    gspdlaarttmfeinvgdtpcvltkedyrtlgamtegysgsdiavvvkdalmqpirkiqs
    athfkdvsteddetrkltpcspgddgaiemswtdieadelkepdltikdflkaikst
    

    Sequence, based on observed residues (ATOM records):
    >3mhvC (C:)
    gspdlaarttmfeinvgdtpcvltkedyrtlgamtegysgsdiavvvkdalmqpirkiqs
    athfkdvsetrkltpcspgddgaiemspdltikdflkaikst