PDB entry 3mhq

View 3mhq on RCSB PDB site
Description: human Plk1-PBD with a glycerol bound at the phophopeptide binding site
Class: transferase
Keywords: beta barrel, transferase
Deposited on 2010-04-08, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.185
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhqa1, d3mhqa2
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhqb1, d3mhqb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mhqA (A:)
    snagevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkygl
    gyqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfr
    nymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklil
    cplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssrsasnrlkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhqA (A:)
    chlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdns
    vgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehll
    kaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavt
    yidekrdfrtyrlslleeygcckelasrlryartmvdkllss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mhqB (B:)
    snagevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkygl
    gyqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfr
    nymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklil
    cplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssrsasnrlkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhqB (B:)
    dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn
    svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl
    lkaganitprrlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidek
    rdfrtyrlslleeygcckelasrlryartmvdkllssr