PDB entry 3mhp

View 3mhp on RCSB PDB site
Description: FNR-recruitment to the thylakoid
Deposited on 2010-04-08, released 2010-10-27
The last revision was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin--NADP reductase, leaf isozyme, chloroplastic
    Species: Pisum sativum [TaxId:3888]
    Gene: PETH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933 (0-294)
      • expression tag (295)
  • Chain 'B':
    Compound: Ferredoxin--NADP reductase, leaf isozyme, chloroplastic
    Species: Pisum sativum [TaxId:3888]
    Gene: PETH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933 (0-294)
      • expression tag (295)
  • Chain 'C':
    Compound: TIC62_peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mhpA (A:)
    skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
    pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
    kpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglaw
    lflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelw
    ellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevyl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mhpB (B:)
    skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
    pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
    kpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglaw
    lflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelw
    ellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevyl
    

    Sequence, based on observed residues (ATOM records):
    >3mhpB (B:)
    skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
    pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvyvkgvcsnflcdlkpgsevk
    itgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvpt
    sssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdn
    tfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevyl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3mhpC (C:)
    kteqplspytayddlkppsspsptkp