PDB entry 3mhn

View 3mhn on RCSB PDB site
Description: Human Plk1-PBD in complex with Poloxime ((E)-4-(hydroxyimino)-2-isopropyl-5-methylcyclohexa-2,5-dienone)
Class: transferase/transferase inhibitor
Keywords: BETA BARREL, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-04-08, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhna1, d3mhna2
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhnb1, d3mhnb2
  • Heterogens: GOL, PXE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mhnA (A:)
    snagevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkygl
    gyqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfr
    nymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklil
    cplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssrsasnrlkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhnA (A:)
    dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn
    svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl
    lkaganitpredelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavt
    yidekrdfrtyrlslleeygcckelasrlryartmvdkllss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mhnB (B:)
    snagevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkygl
    gyqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfr
    nymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklil
    cplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssrsasnrlkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhnB (B:)
    chlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdns
    vgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehll
    kaganitprrlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekr
    dfrtyrlslleeygcckelasrlryartmvdkllss