PDB entry 3mhj

View 3mhj on RCSB PDB site
Description: Human tankyrase 2 - catalytic PARP domain in complex with 1-methyl-3-(trifluoromethyl)-5h-benzo[c][1,8]naphtyridine-6-one
Deposited on 2010-04-08, released 2010-05-05
The last revision was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, M3F, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mhjA (A:)
    mhhhhhhssgvdlgtenlyfqsmlntsgsgtilidlspddkefqsveeemqstvrehrdg
    ghaggifnrynilkiqkvcnkklwerythrrkevseenhnhanermlfhgspfvnaiihk
    gfderhayiggmfgagiyfaenssksnqyvygigggtgcpvhkdrscyichrqllfcrvt
    lgksflqfsamkmahsppghhsvtgrpsvnglalaeyviyrgeqaypeylityqimrpeg
    

    Sequence, based on observed residues (ATOM records):
    >3mhjA (A:)
    gtilidlspddkefqsveeemqstvrehrdgghaggifnrynilkiqkvcnkklweryth
    rrkevseenhnhanermlfhgspfvnaiihkgfderhayiggmfgagiyfaenssksnqy
    vygigggtgcpvhkdrscyichrqllfcrvtlgksflqfsamahsppghhsvtgrpsvng
    lalaeyviyrgeqaypeylityqimrpe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mhjB (B:)
    mhhhhhhssgvdlgtenlyfqsmlntsgsgtilidlspddkefqsveeemqstvrehrdg
    ghaggifnrynilkiqkvcnkklwerythrrkevseenhnhanermlfhgspfvnaiihk
    gfderhayiggmfgagiyfaenssksnqyvygigggtgcpvhkdrscyichrqllfcrvt
    lgksflqfsamkmahsppghhsvtgrpsvnglalaeyviyrgeqaypeylityqimrpeg
    

    Sequence, based on observed residues (ATOM records):
    >3mhjB (B:)
    gtilidlspddkefqsveeemqstvrehrdgghaggifnrynilkiqkvcnkklweryth
    rrkevseenhnhanermlfhgspfvnaiihkgfderhayiggmfgagiyfaenssksnqy
    vygigggtgcpvhkdrscyichrqllfcrvtlgksflqfsaahsppghhsvtgrpsvngl
    alaeyviyrgeqaypeylityqimrpe