PDB entry 3mhd

View 3mhd on RCSB PDB site
Description: Crystal structure of DCR3
Deposited on 2010-04-07, released 2011-02-23
The last revision was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.286
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: DCR3, TNFRSF6B, TR6
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mhdD (D:)
    vaetptypwrdaetgerlvcaqcppgtfvqrpcrrdspttcgpcpprhytqfwnylercr
    ycnvlcgereeearachathnracrcrtgffahagfclehascppgagviapgtpsqntq
    cqpcppgtfsassssseqcqphrnctalglalnvpgssshdtlctstghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mhdD (D:)
    etptypwrdaetgerlvcaqcppgtfvqrpcrrdspttcgpcpprhytqfwnylercryc
    nvlcgereeearachathnracrcrtgffahagfclehascppgagviapgtpsqntqct
    fsassssseq