PDB entry 3mhb

View 3mhb on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L38A at cryogenic temperature
Class: hydrolase
Keywords: hyperstable variant, hydrolase, pdtp, cavity, pressure
Deposited on 2010-04-07, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (37)
      • engineered (43-44)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.07: d3mhba_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mhbA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrllavdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhbA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrllavdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws