PDB entry 3mha

View 3mha on RCSB PDB site
Description: Crystal structure of LprG from Mycobacterium tuberculosis bound to PIM
Class: lipid binding protein
Keywords: Lipoprotein, LprG, glycolipid binding protein, LIPID BINDING PROTEIN, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on 2010-04-07, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.224
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lpp-27, lprG, MT1455, MTCY21B4.28c, Rv1411c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mhaa_
  • Chain 'B':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lpp-27, lprG, MT1455, MTCY21B4.28c, Rv1411c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5I8 (7-End)
      • expression tag (5-6)
    Domains in SCOPe 2.07: d3mhab1, d3mhab2
  • Heterogens: Z69, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mhaA (A:)
    mhhhhhhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaat
    gnvkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlan
    fadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaq
    ldrgsgnsvqmtlskwgekvqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhaA (A:)
    gplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkltl
    ggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadakae
    grdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsgn
    svqmtlskwgekvqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mhaB (B:)
    mhhhhhhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaat
    gnvkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlan
    fadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaq
    ldrgsgnsvqmtlskwgekvqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mhaB (B:)
    hhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkl
    tlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadak
    aegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgs
    gnsvqmtlskwgekv