PDB entry 3mh9

View 3mh9 on RCSB PDB site
Description: Crystal structure of LprG mutant V91W from Mycobacterium tuberculosis
Class: lipid binding protein
Keywords: Lipoprotein, mutant LprG, glycolipid binding protein, LIPID BINDING PROTEIN, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on 2010-04-07, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.217
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lpp-27, lprG, MT1455, MTCY21B4.28c, Rv1411c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5I8 (Start-209)
      • engineered (64)
      • expression tag (210-212)
    Domains in SCOPe 2.07: d3mh9a1, d3mh9a2
  • Chain 'C':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lpp-27, lprG, MT1455, MTCY21B4.28c, Rv1411c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5I8 (Start-209)
      • engineered (64)
      • expression tag (210-211)
    Domains in SCOPe 2.07: d3mh9c1, d3mh9c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mh9A (A:)
    mssgskpsggplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnpta
    atgnwkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvl
    anfadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaq
    aqldrgsgnsvqmtlskwgekvqvtkppvsklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mh9A (A:)
    ggplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnwklt
    lggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadaka
    egrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsg
    nsvqmtlskwgekvqvtkppvsklh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mh9C (C:)
    mssgskpsggplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnpta
    atgnwkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvl
    anfadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaq
    aqldrgsgnsvqmtlskwgekvqvtkppvsklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mh9C (C:)
    sggplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnwkl
    tlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadak
    aegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgs
    gnsvqmtlskwgekvqvtkppvskl