PDB entry 3mh8

View 3mh8 on RCSB PDB site
Description: Crystal structure of LprG from Mycobacterium tuberculosis
Class: lipid binding protein
Keywords: Lipoprotein, LprG, glycolipid binding protein, Structural Genomics, TB Structural Genomics Consortium, TBSGC, LIPID BINDING PROTEIN
Deposited on 2010-04-07, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lpp-27, lprG, MT1455, MTCY21B4.28c, Rv1411c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mh8a_
  • Chain 'B':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lpp-27, lprG, MT1455, MTCY21B4.28c, Rv1411c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mh8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mh8A (A:)
    mhhhhhhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaat
    gnvkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlan
    fadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaq
    ldrgsgnsvqmtlskwgekvqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mh8A (A:)
    gplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkltl
    ggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadakae
    grdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsgn
    svqmtlskwgekvqvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mh8B (B:)
    mhhhhhhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaat
    gnvkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlan
    fadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaq
    ldrgsgnsvqmtlskwgekvqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mh8B (B:)
    gplpdakplveeataqtkalksahmvltvngkipslktlsgdlttnptaatgnvkltlgg
    sdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadakaegr
    dtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsgnsv
    qmtlskwgekvqvt