PDB entry 3mh7

View 3mh7 on RCSB PDB site
Description: HtrA proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Deposited on 2010-04-07, released 2010-06-30
The last revision was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.201
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease do
    Species: Escherichia coli [TaxId:83333]
    Gene: degP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0V0 (Start-447)
      • engineered mutation (209)
  • Chain 'B':
    Compound: 5-mer peptide
    Species: Escherichia coli [TaxId:83333]
    Gene: degP
    Database cross-references and differences (RAF-indexed):
    • PDB 3MH7
  • Chain 'C':
    Compound: 5-mer peptide
    Species: Escherichia coli [TaxId:83333]
    Gene: degP
    Database cross-references and differences (RAF-indexed):
    • PDB 3MH7 (0-4)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mh7A (A:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnaggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmqrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mh7A (A:)
    qmpslapmlekvmpsvvsinvegstqkfmalgsgviidadkgyvvtnnhvvdnatvikvq
    lsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglget
    vtsgivsalgrsglnaenyenfiqtdaainrgnaggalvnlngeligintailapdggni
    gigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpn
    ssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqq
    ssqnqvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavk
    niaelrkvldskpsvlalniqrgdstiyllmq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mh7B (B:)
    xxxxx
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3mh7C (C:)
    xxxxx