PDB entry 3mh4

View 3mh4 on RCSB PDB site
Description: HtrA proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Class: Hydrolase
Keywords: DegP, HtrA, protease, Hydrolase
Deposited on 2010-04-07, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.259
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease do
    Species: Escherichia coli [TaxId:83333]
    Gene: degP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0V0
      • engineered (209)
    Domains in SCOPe 2.07: d3mh4a1, d3mh4a2
  • Chain 'B':
    Compound: Protease do
    Species: Escherichia coli [TaxId:83333]
    Gene: degP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0V0
      • engineered (209)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mh4A (A:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnaggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmqrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mh4A (A:)
    qmpslapmlekvmpsvvsinvegsttvntprmprgqqqkfmalgsgviidadkgyvvtnn
    hvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdyt
    vaignpfglgetvtsgivsalgrsnfiqtdaainrgnaggalvnlngeligintailapd
    ggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsq
    vlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnl
    e
    

  • Chain 'B':
    No sequence available.