PDB entry 3mgz

View 3mgz on RCSB PDB site
Description: Crystal structure of DHBPS domain of bi-functional DHBPS/GTP cyclohydrolase II from Mycobacterium tuberculosis at pH 4.0
Class: lyase
Keywords: DHBPS, ribA2, antibacterial, drug target, Ribulose-5-phosphate, riboflavin, LYASE
Deposited on 2010-04-07, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: ribA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgza_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgzA (A:)
    mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
    ldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrlladptsvad
    dftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtde
    lrvfadehglalitiadliewrrkhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgzA (A:)
    mtrldsveravadiaagkavividdrenegdlifaaekatpemvafmvrytsgylcvpld
    gaicdrlgllpytvtvdarngigtgisasdrattmrlladptsvaddftrpghvvplrak
    dggvlrrpghteaavdlarmaglqpagaiceivsmahtdelrvfadehglalitiadlie
    wrrkhe