PDB entry 3mgx

View 3mgx on RCSB PDB site
Description: Crystal Structure of P450 OxyD that is involved in the Biosynthesis of Vancomycin-type Antibiotics
Class: oxidoreductase
Keywords: Cytochrome P450 Oxidase, Haem Protein, Vancomycin Biosynthesis, Carrier Protein, OXIDOREDUCTASE
Deposited on 2010-04-07, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative P450 monooxygenase
    Species: Amycolatopsis balhimycina [TaxId:208443]
    Gene: oxyD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgxa_
  • Chain 'B':
    Compound: Putative P450 monooxygenase
    Species: Amycolatopsis balhimycina [TaxId:208443]
    Gene: oxyD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgxb_
  • Heterogens: HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgxA (A:)
    gsshhhhhhssglvprgshmqttnavdlgnpdlyttlerharwrelaaedamvwsdpgss
    psgfwsvfshracaavlapsapltseygmmigfdrdhpdnsggrmmvvseheqhrklrkl
    vgpllsraaarklaervrievgdvlgrvldgevcdaataigpripaavvceilgvpaede
    dmlidltnhafggedelfdgmtprqahteilvyfdelitarrkepgddlvstlvtdddlt
    iddvllncdnvliggnettrhaitgavhalatvpglltalrdgsadvdtvveevlrwtsp
    amhvlrvttadvtingrdlpsgtpvvawlpaanrdpaefddpdtflpgrkpnrhitfghg
    mhhclgsalarielsvvlrvlaervsrvdlerepawlraivvqgyrelpvrftgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgxA (A:)
    avdlgnpdlyttlerharwrelaaedamvwsdpgsspsgfwsvfshracaavlapsaplt
    seygmmigfdrdhpdnsggrmmvvseheqhrklrklvgpllsraaarklaervrievgdv
    lgrvldgevcdaataigpripaavvceilgvpaededmlidltnhafggedgmtprqaht
    eilvyfdelitarrkepgddlvstlvtdddltiddvllncdnvliggnettrhaitgavh
    alatvpglltalrdgsadvdtvveevlrwtspamhvlrvttadvtingrdlpsgtpvvaw
    lpaanrdpaefddpdtflpgrkpnrhitfghgmhhclgsalarielsvvlrvlaervsrv
    dlerepawlraivvqgyrelpvrftgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mgxB (B:)
    gsshhhhhhssglvprgshmqttnavdlgnpdlyttlerharwrelaaedamvwsdpgss
    psgfwsvfshracaavlapsapltseygmmigfdrdhpdnsggrmmvvseheqhrklrkl
    vgpllsraaarklaervrievgdvlgrvldgevcdaataigpripaavvceilgvpaede
    dmlidltnhafggedelfdgmtprqahteilvyfdelitarrkepgddlvstlvtdddlt
    iddvllncdnvliggnettrhaitgavhalatvpglltalrdgsadvdtvveevlrwtsp
    amhvlrvttadvtingrdlpsgtpvvawlpaanrdpaefddpdtflpgrkpnrhitfghg
    mhhclgsalarielsvvlrvlaervsrvdlerepawlraivvqgyrelpvrftgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgxB (B:)
    avdlgnpdlyttlerharwrelaaedamvwsdpgsspsgfwsvfshracaavlapsaplt
    seygmmigfdrdhpdnsggrmmvvseheqhrklrklvgpllsraaarklaervrievgdv
    lgrvldgevcdaataigpripaavvceilgvpaededmlidltnhafggedelfdgmtpr
    qahteilvyfdelitarrkepgddlvstlvtdddltiddvllncdnvliggnettrhait
    gavhalatvpglltalrdgsadvdtvveevlrwtspamhvlrvttadvtingrdlpsgtp
    vvawlpaanrdpaefddpdtflpgrkpnrhitfghgmhhclgsalarielsvvlrvlaer
    vsrvdlerepawlraivvqgyrelpvrftgr