PDB entry 3mgv

View 3mgv on RCSB PDB site
Description: Cre recombinase-DNA transition state
Class: isomerase/DNA
Keywords: CRE-LOXP, TRANSITION STATE, ISOMERASE-DNA complex
Deposited on 2010-04-07, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgva1, d3mgva2
  • Chain 'B':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgvb1, d3mgvb2
  • Chain 'C':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgvc1, d3mgvc2
  • Chain 'D':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgvd1, d3mgvd2
  • Chain 'E':
    Compound: DNA (5'-d(*tp*ap*tp*ap*ap*cp*tp*tp*cp*gp*tp*ap*tp*ap*g)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*cp*ap*tp*ap*tp*gp*cp*tp*ap*tp*ap*cp*gp*ap*ap*gp*tp*tp*ap*t)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*tp*ap*tp*ap*ap*cp*tp*tp*cp*gp*tp*ap*tp*ap*g)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*cp*ap*tp*ap*tp*gp*cp*tp*ap*tp*ap*cp*gp*ap*ap*gp*tp*tp*ap*t)-3')
  • Chain 'I':
    Compound: DNA (5'-d(*tp*ap*tp*ap*ap*cp*tp*tp*cp*gp*tp*ap*tp*ap*g)-3')
  • Chain 'K':
    Compound: DNA (5'-d(*cp*ap*tp*ap*tp*gp*cp*tp*ap*tp*ap*cp*gp*ap*ap*gp*tp*tp*ap*t)-3')
  • Chain 'L':
    Compound: DNA (5'-d(*tp*ap*tp*ap*ap*cp*tp*tp*cp*gp*tp*ap*tp*ap*g)-3')
  • Chain 'M':
    Compound: DNA (5'-d(*cp*ap*tp*ap*tp*gp*cp*tp*ap*tp*ap*cp*gp*ap*ap*gp*tp*tp*ap*t)-3')
  • Heterogens: VO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgvA (A:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgvA (A:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mgvB (B:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgvB (B:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mgvC (C:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgvC (C:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mgvD (D:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgvD (D:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.