PDB entry 3mgs

View 3mgs on RCSB PDB site
Description: binding of cesium ions to the nucleosome core particle
Deposited on 2010-04-07, released 2010-06-16
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 3 or H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • see remark 999 (101)
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 4 or H4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 2A or H2A, LOC494591
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 2B or H2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 3 or H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • see remark 999 (101)
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 4 or H4
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 2A or H2A, LOC494591
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone 2B or H2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • see remark 999 (31)
  • Chain 'I':
    Compound: DNA (147-mer)
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: DNA (147-mer)
    Species: synthetic, synthetic
  • Heterogens: CL, CS, MN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mgsA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records):
    >3mgsA (A:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mgsB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records):
    >3mgsB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mgsC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records):
    >3mgsC (C:)
    ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mgsD (D:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records):
    >3mgsD (D:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mgsE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records):
    >3mgsE (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mgsF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records):
    >3mgsF (F:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mgsG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records):
    >3mgsG (G:)
    kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mgsH (H:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records):
    >3mgsH (H:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.