PDB entry 3mgm

View 3mgm on RCSB PDB site
Description: Crystal structure of human NUDT16
Deposited on 2010-04-07, released 2011-04-20
The last revision was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u8 snorna-decapping enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hNUDT16, NUDT16
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: u8 snorna-decapping enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hNUDT16, NUDT16
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mgmA (A:)
    mmagarrlelgealalgsgwrhachallyapdpgmlfgriplryailmqmrfdgrlgfpg
    gfvdtqdrsledglnrelreelgeaaaafrvertdyrsshvgsgprvvahfyakrltlee
    llaveagatrakdhglevlglvrvplytlrdgvgglptflensfigsareqllealqdlg
    llqsgsisglkipahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mgmA (A:)
    gwrhachallyapdpgmlfgriplryailmqmrfdgrlgfpggfvdtqdrsledglnrel
    reelgeaaaafrvertdyrsshvgsgprvvahfyakrltleellaveagatrakdhglev
    lglvrvplytlrdgvgglptflensfigsareqllealqdlgll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mgmB (B:)
    mmagarrlelgealalgsgwrhachallyapdpgmlfgriplryailmqmrfdgrlgfpg
    gfvdtqdrsledglnrelreelgeaaaafrvertdyrsshvgsgprvvahfyakrltlee
    llaveagatrakdhglevlglvrvplytlrdgvgglptflensfigsareqllealqdlg
    llqsgsisglkipahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mgmB (B:)
    gwrhachallyapdpgmlfgriplryailmqmrfdgrlgfpggfvdtqdrsledglnrel
    reelgeaaaafrvertdyrsshvgsgprvvahfyakrltleellaveagatrakdhglev
    lglvrvplytlrdgvgglptflensfigsareqllealqdlgll