PDB entry 3mgl

View 3mgl on RCSB PDB site
Description: crystal structure of permease family protein from vibrio cholerae
Deposited on 2010-04-06, released 2010-04-21
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfate permease family protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_A0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KN88 (3-End)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Sulfate permease family protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_A0077
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mglA (A:)
    snaemsyelaqhgrstlprelavyalegpfffaaaetfervmgsiqetpqililrlkwvp
    fmditgiqtleemiqsfhkrgikvlisgansrvsqklvkagivklvgeqnvypvfegals
    aalteieaqp
    

    Sequence, based on observed residues (ATOM records):
    >3mglA (A:)
    naemsyelaqhgrstlprelavyalegpfffaaaetfervmgsiqetpqililrlkwvpf
    mditgiqtleemiqsfhkrgikvlisgansrvsqklvkagivklvgeqnvypvfegalsa
    alteieaq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mglB (B:)
    snaemsyelaqhgrstlprelavyalegpfffaaaetfervmgsiqetpqililrlkwvp
    fmditgiqtleemiqsfhkrgikvlisgansrvsqklvkagivklvgeqnvypvfegals
    aalteieaqp
    

    Sequence, based on observed residues (ATOM records):
    >3mglB (B:)
    emsyelaqhgrstlprelavyalegpfffaaaetfervmgsiqetpqililrlkwvpfmd
    itgiqtleemiqsfhkrgikvlisgansrvsqklvkagivklvgeqnvypvfegalsaal
    teieaq