PDB entry 3mgk

View 3mgk on RCSB PDB site
Description: CRYSTAL STRUCTURE OF PROBABLE PROTEASE/AMIDASE FROM Clostridium acetobutylicum ATCC 824
Class: structural genomics, unknown function
Keywords: AMIDOTRANFERASE-LIKE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NYSGRC, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, New York SGX Research Center for Structural Genomics, unknown function
Deposited on 2010-04-06, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intracellular protease/amidase related enzyme (ThiJ family)
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CA_C2826
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgka_
  • Chain 'B':
    Compound: Intracellular protease/amidase related enzyme (ThiJ family)
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CA_C2826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97FB4 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3mgkb1, d3mgkb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgkA (A:)
    mslsyridvllfnkfetldvfgpveifgnlqddfelnfissdgglvessqkvrvetslyt
    rdeniekilfvpggsgtrekvnddnfinfignmvkeskyiisvctgsallskagilngkr
    attnkrsfkwvteqnedvlwvkearwvkdgniytssgvsagidmtlgfiedligkekale
    isrsieyfwnedsnydpfskiygeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgkA (A:)
    syridvllfnkfetldvfgpveifgnlqddfelnfissdgglvessqkvrvetslytrde
    niekilfvpggsgtrekvnddnfinfignmvkeskyiisvctgsallskagilngkratt
    nkrsfkwvteqnedvlwvkearwvkdgniytssgvsagidmtlgfiedligkekaleisr
    sieyfwnedsnydpfskiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mgkB (B:)
    mslsyridvllfnkfetldvfgpveifgnlqddfelnfissdgglvessqkvrvetslyt
    rdeniekilfvpggsgtrekvnddnfinfignmvkeskyiisvctgsallskagilngkr
    attnkrsfkwvteqnedvlwvkearwvkdgniytssgvsagidmtlgfiedligkekale
    isrsieyfwnedsnydpfskiygeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgkB (B:)
    slsyridvllfnkfetldvfgpveifgnlqddfelnfissdgglvessqkvrvetslytr
    deniekilfvpggsgtrekvnddnfinfignmvkeskyiisvctgsallskagilngkra
    ttnkrsfkwvteqnedvlwvkearwvkdgniytssgvsagidmtlgfiedligkekalei
    srsieyfwnedsnydpfskiy