PDB entry 3mgj

View 3mgj on RCSB PDB site
Description: crystal structure of the saccharop_dh_n domain of mj1480 protein from methanococcus jannaschii. northeast structural genomics consortium target mjr83a.
Deposited on 2010-04-06, released 2010-04-21
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein MJ1480
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ1480
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein MJ1480
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ1480
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mgjA (A:)
    mfmreielrghiidslilpkvfdkildmggdykvlefeigkrktdpsyakilvigrderh
    vdeilnelrdlgaeipeieevelqpaekdmvlpegfysttnhktfirfkglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mgjA (A:)
    mfmreielrghiidslilpkvfdkildmggdykvlefeigkrktdpsyakilvigrderh
    vdeilnelrdlgaeipeieevelqpaekdmvlpegfy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mgjB (B:)
    mfmreielrghiidslilpkvfdkildmggdykvlefeigkrktdpsyakilvigrderh
    vdeilnelrdlgaeipeieevelqpaekdmvlpegfysttnhktfirfkglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mgjB (B:)
    mfmreielrghiidslilpkvfdkildmggdykvlefeigkrktdpsyakilvigrderh
    vdeilnelrdlgaeipeieevelqpa