PDB entry 3mgi

View 3mgi on RCSB PDB site
Description: Ternary complex of a DNA polymerase lambda loop mutant
Class: Lyase,Transferase/DNA
Keywords: protein-DNA complex, Lyase, Transferase-DNA complex
Deposited on 2010-04-06, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-220)
    • Uniprot Q9UGP5 (225-328)
      • see remark 999 (221-224)
    Domains in SCOPe 2.07: d3mgia1, d3mgia2, d3mgia3
  • Chain 'D':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
  • Chain 'P':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*t)-3')
  • Chain 'T':
    Compound: DNA
  • Heterogens: D3T, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgiA (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgiA (A:)
    hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
    kiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasltt
    qqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvl
    ithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpy
    sefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptpte
    kdvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.