PDB entry 3mgf

View 3mgf on RCSB PDB site
Description: Crystal Structure of Monomeric Kusabira-Orange (MKO), Orange-Emitting GFP-like Protein, at pH 7.5
Class: fluorescent protein
Keywords: Fluorescent protein
Deposited on 2010-04-06, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein
    Species: Verrillofungia concinna [TaxId:496660]
    Gene: mKO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I7B2 (Start-220)
      • chromophore (68)
    Domains in SCOPe 2.07: d3mgfa_
  • Chain 'B':
    Compound: fluorescent protein
    Species: Verrillofungia concinna [TaxId:496660]
    Gene: mKO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I7B2 (Start-220)
      • chromophore (68)
    Domains in SCOPe 2.07: d3mgfb_
  • Chain 'C':
    Compound: fluorescent protein
    Species: Verrillofungia concinna [TaxId:496660]
    Gene: mKO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I7B2 (Start-220)
      • chromophore (68)
    Domains in SCOPe 2.07: d3mgfc_
  • Chain 'D':
    Compound: fluorescent protein
    Species: Verrillofungia concinna [TaxId:496660]
    Gene: mKO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I7B2 (Start-220)
      • chromophore (68)
    Domains in SCOPe 2.07: d3mgfd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgfA (A:)
    gahmvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfaf
    dlvshvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntf
    yhkskftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfk
    ttykaakkilkmpgshyishrlvrktegnitelvedavahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgfA (A:)
    svikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvsh
    vfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhksk
    ftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyka
    akkilkmpgshyishrlvrktegnitelvedavahs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mgfB (B:)
    gahmvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfaf
    dlvshvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntf
    yhkskftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfk
    ttykaakkilkmpgshyishrlvrktegnitelvedavahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgfB (B:)
    svikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvsh
    vfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhksk
    ftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyka
    akkmpgshyishrlvrktegnitelvedavahs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mgfC (C:)
    gahmvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfaf
    dlvshvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntf
    yhkskftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfk
    ttykaakkilkmpgshyishrlvrktegnitelvedavahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgfC (C:)
    svikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvsh
    vfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhksk
    ftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyka
    akkilkmpgshyishrlvrktegnitelvedavahs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mgfD (D:)
    gahmvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfaf
    dlvshvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntf
    yhkskftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfk
    ttykaakkilkmpgshyishrlvrktegnitelvedavahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgfD (D:)
    svikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvsh
    vfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhksk
    ftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyka
    akkilkmpgshyishrlvrktegnitelvedavahs