PDB entry 3mge

View 3mge on RCSB PDB site
Description: X-ray Structure of Hexameric HIV-1 CA
Class: viral protein
Keywords: virus capsid, hexamer, engineered disulfide bonds, VIRAL PROTEIN
Deposited on 2010-04-05, released 2010-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.231
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (41)
      • engineered (53)
    Domains in SCOPe 2.06: d3mgea1, d3mgea2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgeA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgeA (A:)
    pivmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvgghqaam
    qmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipv
    geiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtetllvqnan
    pdcktilkalgpgatleemmtacq