PDB entry 3mgd

View 3mgd on RCSB PDB site
Description: crystal structure of predicted acetyltransferase with acetyl-coa from clostridium acetobutylicum at the resolution 1.9a, northeast structural genomics consortium target car165
Deposited on 2010-04-05, released 2010-04-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted acetyltransferase
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CA_C0160
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97MN4 (2-148)
      • expression tag (0-1)
      • expression tag (149-152)
  • Chain 'B':
    Compound: Predicted acetyltransferase
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CA_C0160
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97MN4 (2-148)
      • expression tag (0-1)
      • expression tag (149-153)
  • Heterogens: ACO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mgdA (A:)
    mmnyrkadmkdisllvsirkrqlidegiepnididkeltryfnnklannllvewiaeenn
    qiiataaiafidfpptytnktgrkgyitnmyteptsrgngiatgmldrlvneakernihk
    iclvasklgrpvykkygfqdtdewlelnllehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mgdA (A:)
    mmnyrkadmkdisllvsirkrqlidegiepnididkeltryfnnklannllvewiaeenn
    qiiataaiafidfpptytnktgrkgyitnmyteptsrgngiatgmldrlvneakernihk
    iclvasklgrpvykkygfqdtdewlelnllehh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mgdB (B:)
    mmnyrkadmkdisllvsirkrqlidegiepnididkeltryfnnklannllvewiaeenn
    qiiataaiafidfpptytnktgrkgyitnmyteptsrgngiatgmldrlvneakernihk
    iclvasklgrpvykkygfqdtdewlelnllehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mgdB (B:)
    mmnyrkadmkdisllvsirkrqlidegiepnididkeltryfnnklannllvewiaeenn
    qiiataaiafidfpptytnktgrkgyitnmyteptsrgngiatgmldrlvneakernihk
    iclvasklgrpvykkygfqdtdewlelnllehhh