PDB entry 3mgb

View 3mgb on RCSB PDB site
Description: Teg 12 Ternary Structure Complexed with PAP and the Teicoplanin Aglycone
Class: transferase/antibiotic
Keywords: sulfotransferase, glycopeptide, antibiotic, transferase-antibiotic complex
Deposited on 2010-04-05, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Teg12
    Species: uncultured soil bacterium [TaxId:164851]
    Gene: teg1, teg12
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7T1D7 (34-318)
      • expression tag (2-11)
      • expression tag (33)
  • Chain 'B':
    Compound: Teg12
    Species: uncultured soil bacterium [TaxId:164851]
    Gene: teg1, teg12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgbb_
  • Chain 'C':
    Compound: teicoplanin aglycone
    Species: NONOMURAEA SP. ATCC 39727 [TaxId:93944]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MGB (0-6)
  • Chain 'D':
    Compound: teicoplanin aglycone
    Species: NONOMURAEA SP. ATCC 39727 [TaxId:93944]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MGB (0-6)
  • Heterogens: PAP, ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mgbB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmngirwiasypkagntwvrcmlaayi
    tgkapqvwndidaesltleamlrfgdlppaepmepvlvkthlkadvpvlglygeatakvl
    ylvrnprdmllssmrmasisrddveksrdfarkfianeglgwnalgagggvglgswpenv
    rswtesssdrfpnadvltmryedlkgdpvarfseivefldlggpvdiedirravaastle
    rmrelekrseqqgggspirhgdarmmkggpggarpqfvgegrydqslsflgediesdyqe
    llhgdsgfalyakqygyag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgbB (B:)
    mngirwiasypkagntwvrcmlaayitgkapqvwndidaesltleamlrfgdlppaepme
    pvlvkthlkadvpvlglygeatakvlylvrnprdmllssmrmasisrddveksrdfarkf
    ianeglgwngvglgswpenvrswtesssdrfpnadvltmryedlkgdpvarfseivefld
    lggpvdiedirravaastlermrelekrseqqgggspirpqfvgegrydqslsflgedie
    sdyqellhgdsgfalyakqygyag
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.