PDB entry 3mga

View 3mga on RCSB PDB site
Description: 2.4 Angstrom Crystal Structure of Ferric Enterobactin Esterase (fes) from Salmonella typhimurium
Class: hydrolase
Keywords: Center for Structural Genomics of Infectious Diseases, CSGID, Ferric Enterobactin Esterase, HYDROLASE
Deposited on 2010-04-05, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterochelin esterase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: fes, STM0586
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgaa1, d3mgaa2
  • Chain 'B':
    Compound: enterochelin esterase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: fes, STM0586
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mgab1, d3mgab2
  • Heterogens: CL, GOL, PEG, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mgaA (A:)
    snamkealatgseawwrtktgpewirekdgnyrvtfwwrdpqgnethspirrvwvyitgv
    tdhhqnaqpqtmariagtdvwrwstalsanwrgsycfipterddvfaafapgetpdrnvl
    regwrqllpqaiadplnsqswrggrghavsalempdaplqpgwdrpetpyspplmmqwhs
    erlgnsrrvwilttgdeapeerplailldgqfwaenmpvwpalaslthqrllpgavylli
    daidtqhrsqelpcnadfwlavqqellpqvravtpfsddagrtvvagqsfgglsalyagl
    nwptrfgcvlsqsgsfwwphritppegevitrlktgalcarglrivleagvrepivfqan
    qalyaqlntsqqsifwrqvdgghdalcwrggltqglmllwqplidtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgaA (A:)
    tgseawwrtktgpewirekdgnyrvtfwwrdpqgnethspirrvwvyitgvtdhhqnaqp
    qtmariagtdvwrwstalsanwrgsycfipterddvfaafapgetpdrnvlregwrqllp
    qaiadplnsqswrggrghavsalempdaplqpgwdrpetpyspplmmqwhserlgnsrrv
    wilttgdeapeerplailldgqfwaenmpvwpalaslthqrllpgavyllidaidtqhrs
    qelpcnadfwlavqqellpqvravtpfsddagrtvvagqsfgglsalyaglnwptrfgcv
    lsqsgsfwwphritppegevitrlktgalcarglrivleagvrepivfqanqalyaqlnt
    sqqsifwrqvdgghdalcwrggltqglmllwqplidt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mgaB (B:)
    snamkealatgseawwrtktgpewirekdgnyrvtfwwrdpqgnethspirrvwvyitgv
    tdhhqnaqpqtmariagtdvwrwstalsanwrgsycfipterddvfaafapgetpdrnvl
    regwrqllpqaiadplnsqswrggrghavsalempdaplqpgwdrpetpyspplmmqwhs
    erlgnsrrvwilttgdeapeerplailldgqfwaenmpvwpalaslthqrllpgavylli
    daidtqhrsqelpcnadfwlavqqellpqvravtpfsddagrtvvagqsfgglsalyagl
    nwptrfgcvlsqsgsfwwphritppegevitrlktgalcarglrivleagvrepivfqan
    qalyaqlntsqqsifwrqvdgghdalcwrggltqglmllwqplidtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mgaB (B:)
    seawwrtktgpewirekdgnyrvtfwwrdpqgnethspirrvwvyitgvtdhhqnaqpqt
    mariagtdvwrwstalsanwrgsycfipterddvfaafapgetpdrnvlregwrqllpqa
    iadplnsqswrggrghavsalempdaplqpgwdrpetpyspplmmqwhserlgnsrrvwi
    lttgdeapeerplailldgqfwaenmpvwpalaslthqrllpgavyllidaidtqhrsqe
    lpcnadfwlavqqellpqvravtpfsddagrtvvagqsfgglsalyaglnwptrfgcvls
    qsgsfwwphritppegevitrlktgalcarglrivleagvrepivfqanqalyaqlntsq
    qsifwrqvdgghdalcwrggltqglmllwqplidt