PDB entry 3mg5

View 3mg5 on RCSB PDB site
Description: Core-streptavidin mutant F130L in complex with biotin
Class: biotin-binding protein
Keywords: BIOTIN-BINDING PROTEIN, Streptavidin
Deposited on 2010-04-05, released 2010-05-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.134
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (117)
    Domains in SCOPe 2.01: d3mg5a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (117)
    Domains in SCOPe 2.01: d3mg5b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (117)
    Domains in SCOPe 2.01: d3mg5c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (117)
    Domains in SCOPe 2.01: d3mg5d_
  • Heterogens: BTN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mg5A (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mg5A (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltkvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mg5B (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mg5B (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltkvkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mg5C (C:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mg5C (C:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltkvkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mg5D (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mg5D (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltkvkp